PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00043.1.g04920.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 842aa    MW: 92452.5 Da    PI: 6.6633
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00043.1.g04920.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-28588639152
                          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                     aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Zjn_sc00043.1.g04920.1.sm.mkhc 588 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 639
                                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.382578659IPR003035RWP-RK domain
PfamPF020425.7E-26591639IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MDLDPSPSSA PGDGACGSGD VRPFDTLTTS LLFSSVSTSQ PLPPLPANSS SWLTPPSPLW  60
LFEDRQLLPI ETPAALPEAA AAVVDEVQRA RSGNSDTTTK RVEQINQKWQ LHLSLDDDVT  120
ENSSLFKERL TQALRYFKDS TDQHLLVQVW APVKNGDRCV LTTSGQPFVL DHQSIGLVQY  180
RAVSMMYMFS VDGDNAGELG LPGRVYKQKV PEWTPNVQYY SSKEYPRLNH AISYNVHGTV  240
ALPVFDPSAQ ACIAVVELIM TSKKINYACE VDKVCKALEA VNLKSTEIFD HPNVQICNEG  300
RQTALVEILE ILTVICEEHK LPLAQTWVPC KYRSVLAYGG GLKKSCLSFD GSCMGEVCMS  360
TSDVAFHVID ARMWGFRDAC VEHHLQKGQG VAGRAFVSHK PCFSKDIRQF CKLEYPLVHY  420
ARMFGLAGCF AICLQSSYTG HDDYILEFFL PPDCIDEDDQ NALLDSMLTR MKRCLRSLKV  480
VGDTNLYGVS LQLTNVLKIE NEEFKKDVKI DSSEGGISES PEGDTRRGFH EFDTDNKRLS  540
NMTEGHLLGN EYSQENGTSP TRPNGSGASD SSLLHKTKKP SERRRGKAEK TISLDVLQQY  600
FSGSLKNAAK SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKQVI VSVQGSDAAF  660
NLTSITGPLP IPVGPSLASL NIEKVAQSKG AELSNPAADG DKESSLQNSL GNDCHFGTLM  720
PQQGFIDNNN NAQLEADKAS HSRSSSGEGS LNSHTSEGSC QGSPANQTFV YKPIASTFAE  780
PQINPEFTKE PFQEPQPLLS RMFIKDSGSS KDLKNLFTSA DRCRVGLGGA VAFPFSSPVK  840
WS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457049.10.0hypothetical protein SORBIDRAFT_03g000490
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC5XJJ30.0C5XJJ3_SORBI; Putative uncharacterized protein Sb03g000490
STRINGSb03g000490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein